PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.J01362.1.p
Common NameEUGRSUZ_J01362, LOC104422008
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 412aa    MW: 44669.6 Da    PI: 6.6797
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.J01362.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.79.6e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd++l+ ++++ G g+W++ +++ g+ R++k+c++rw +yl
  Eucgr.J01362.1.p 14 KGPWTPEEDQKLLAYIEENGHGSWRALPSKAGLQRCGKSCRLRWTNYL 61
                      79********************************************97 PP

2Myb_DNA-binding52.89.4e-1767112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
  Eucgr.J01362.1.p  67 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 112
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.0E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.126961IPR017930Myb domain
SuperFamilySSF466898.61E-3011108IPR009057Homeodomain-like
SMARTSM007172.0E-131363IPR001005SANT/Myb domain
PfamPF002491.3E-151461IPR001005SANT/Myb domain
CDDcd001674.05E-101661No hitNo description
PROSITE profilePS5129425.89162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-2665116IPR009057Homeodomain-like
SMARTSM007171.2E-1666114IPR001005SANT/Myb domain
PfamPF002495.0E-1667112IPR001005SANT/Myb domain
CDDcd001674.30E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000902Biological Processcell morphogenesis
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MGRSPCCDKV GLKKGPWTPE EDQKLLAYIE ENGHGSWRAL PSKAGLQRCG KSCRLRWTNY  60
LRPDIKRGKF SLQEEQTIIQ LHALLGNRWS AIATHLPKRT DNEIKNYWNT HLKKRLAKMG  120
IDPVTHKPKN DALVSSDGQS KSAAKLSHLA QWESARLEAE ARLARESKLR SQSFQHHHSS  180
SNSSQVYSAA SALASTSAAP PGLVKKATAP LPPSSPQSLD TLKAWTGSSW PSTKSGEGSG  240
GAGGSANGIA GDLESPTSTL TFSEPMNVLC ENPKQMIEFV GSSGSSDSGM IKEEGEQEWK  300
GLESSITLPE FKEGMGNNAV SFTSTFPEMT MSLEGPWTPE SLRASSVHGN VENNDMEEGF  360
TSLLLNSSGD QSLSDGGGES DKRSDYYEDN KNYWNSILNL VNSSPSESPM F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25121165108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.J01362.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010032514.10.0PREDICTED: myb-related protein 306
TrEMBLA0A059AEV20.0A0A059AEV2_EUCGR; Uncharacterized protein
STRINGPOPTR_0017s12230.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.21e-98myb domain protein 16